CAMPST561
Title : Fowlicidin-2: NMR structure of antimicrobial peptide
PDB : 2GDL
Chain : A
Structure : 2GDL

Display Options

Spacefill
Wire
Ball and stick
Cartoons
Flat
Color atom no.
Color CPK
Color structure
Experimental Method : SOLUTION NMR
Length : 31
Activity : Antimicrobial
Sequence database : CAMPSQ1054, CAMPSQ2800
Sequence : LVQRGRFGRFLRKIRRFRPKVTITIQGSARF
Sequence With Secondary Structure Details
1      LVQRGRFGRF  LRKIRRFRPK  VTITIQGSAR  F
           HHHHSS  SSS    TT    HHHHHHHHH