| CAMPSQ1033 |
| Title : |
Raphanus Sativus Antifungal Protein 1 |
| GenInfo Identifier : |
59798992 |
| Source : |
Raphanus sativus var. niger [Chinese radish] |
| Taxonomy : |
Viridiplantae |
| UniProt: |
P69241 |
| PDB: |
1AYJ |
| PubMed : |
7780308, 1639777 |
| Length : |
51 |
| Activity : |
Antifungal |
| Target : |
[PubMed ID : 7780308 - A. brassicola ( MIC = 15 microg/ml), Botrytis cinerea ( MIC = 8 microg/ml), F. culmorum ( MIC = 5 microg/ml)] [PubMed ID: 1639777 - Alternaria brassicola ( IC50 = 15 ?g/ml) , Ascochyta pisi ( IC50 = 5 ?g/ml) , Botrytis cinerea ( IC50 = 8 ?g/ml) , Cercospora beticola ( IC50 = 2 ?g/ml) , Colletotrichum lindemuthianum ( IC50 = 100 ?g/ml) , Fusarium culmorum ( IC50 = 5 ?g/ml) , Fusarium oxysporum f.sp. lycopersici ( IC50 = 30 ?g/ml) , Fusarium oxysporum f.sp. pisi ( IC50 = 15 ?g/ml) , Mycosphaerella fijiensis var. fijiensis ( IC50 = 4 ?g/ml), Nectria haematococca ( IC50 = 6 ?g/ml), Phoma betae ( IC50 = 2 ?g/ml) , Phytophthora infestans ( IC50 = 3 ?g/ml) , Pyrenophora tritici-repentis ( IC50 = 3 ?g/ml) , Pyricularia oryzae ( IC50 = 0.3 ?g/ml) , Rhizoctonia solani ( IC50 = 100 ?g/ml) , Sclerotinia sclerotiorum ( IC50 = 20 ?g/ml) , Septoria nodorum ( IC50 = 20 ?g/ml) , Trichoderma hamatum ( IC50 = 6 ?g/ml) , Verticillium dahliae ( IC50 = 5 ?g/ml) |
| Validated : |
Experimentally Validated |
| Pfam : |
PF00304 : ( Gamma-thionin family )
|
| InterPro : |
IPR008176 : Gamma-thionin.
IPR003614 : Scorpion_toxin-like.
|
| AMP Family : |
Defensin |
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0005576 |
Cellular Component |
Extracellular region |
IEA |
| GO:0050832 |
Biological Process |
Defense response to fungus |
IEA |
| GO:0031640 |
Biological Process |
Killing of cells of other organism |
IEA |
|
Sequence: |
QKLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC |