| CAMPSQ162 |
| Title : |
Defensin |
| GenInfo Identifier : |
156630495 |
| Source : |
Galleria mellonella [Greater wax moth] |
| Taxonomy : |
Animalia, Insects |
| UniProt: |
P85213 |
| PubMed : |
17194500 |
| Length : |
44 |
| Activity : |
Antifungal |
| Target : |
P. pastoris ( MIC = 8.3-16.5 microM ), Z. marxianus ( MIC = 8.3-16.5 microM ), S. pombe ( MIC = 5.5-11 microM ), C. wickerhamii ( MIC = 8.3-16.5 microM ) |
| Validated : |
Experimentally Validated |
| Comment : |
Inactive against M.luteus, L.monocytogenes, S.aureus, S.lutea, E.coli D31, E. coli ATCC 25922, S. typhimurium, , S.cerevisiae. |
| InterPro : |
IPR001542 : Defensin_invertebrate/fungal.
IPR003614 : Scorpion_toxin-like.
|
| AMP Family : |
Defensin |
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0005615 |
Cellular Component |
Extracellular space |
IDA |
| GO:0050832 |
Biological Process |
Defense response to fungus |
IDA |
| GO:0045087 |
Biological Process |
Innate immune response |
IDA |
| GO:0031640 |
Biological Process |
Killing of cells of other organism |
IEA |
|
Sequence: |
DTLIGSCVWGATNYTSDCNAECKRRGYKGGHCGSFLNVNCWCEE |
