| CAMPSQ163 |
| Title : |
Defensin-like peptide |
| GenInfo Identifier : |
156630496 |
| Source : |
Galleria mellonella [Greater wax moth] |
| Taxonomy : |
Animalia, Insects |
| UniProt: |
P85215 |
| PubMed : |
17194500 |
| Length : |
44 |
| Activity : |
Antibacterial, Antifungal |
| Gram Nature : |
Gram+ve |
| Target : |
S. lutea ( MIC = 1.4?1.9 microM), P. pastoris ( MIC = 1.4-2.9 microM), P. stipitis ( MIC = 2.9 microM), Z. marxianus ( MIC = 1.4-2.9 microM), P. tannophilus ( MIC = 1.4-2.9 microM), C. albicans ( MIC = 1.4-2.9 microM), C. fructus ( MIC = 1.4-2.9 microM), C. wickerhamii ( MIC = 2.9 microM), A. niger ( MIC = 1.4-2.9 microM), T. harzianum ( MIC = 1.4-2.9 microM) |
| Validated : |
Experimentally Validated |
| Comment : |
Inactive against M. luteus, L. monocytogenes, E. coli D31, E. coli ATCC 25922, S. typhimurium, S.cerevisiae, S.pombe, C.albidus, F.oxysporum |
| Pfam : |
PF01097 : ( Arthropod defensin )
|
| InterPro : |
IPR001542 : Defensin_invertebrate/fungal.
IPR003614 : Scorpion_toxin-like.
|
| AMP Family : |
Defensin |
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0005615 |
Cellular Component |
Extracellular space |
IDA |
| GO:0050832 |
Biological Process |
Defense response to fungus |
IDA |
| GO:0050830 |
Biological Process |
Defense response to Gram-positive bacterium |
IDA |
| GO:0045087 |
Biological Process |
Innate immune response |
IDA |
| GO:0031640 |
Biological Process |
Killing of cells of other organism |
IEA |
|
Sequence: |
DKLIGSCVWGATNYTSDCNAECKRRGYKGGHCGSFWNVNCWCEE |
