| CAMPSQ210 |
| Title : |
Ponericin-G1 |
| GenInfo Identifier : |
18202397 |
| Source : |
Pachycondyla goeldii [Ponerine ant] |
| Taxonomy : |
Animalia, Insects |
| UniProt: |
P82414 |
| PubMed : |
11279030 |
| Length : |
30 |
| Activity : |
Antibacterial, Antifungal |
| Gram Nature : |
Gram+ve, Gram-ve |
| Target : |
B. cereus CIP 6624a, B. megaterium ATCC 9885b, B. stearothermophilus CIP 675, B. stearothermophilus CIP 675,?B. subtilis ATCC 6623, Enterococcus faecalis CIP 636, Lactococcus lactis ssp. cremoris I116, Streptococcus pyogenes CIP 561, S. sanguinis CIP 5512, Listeria ivanovii?LMA 94?1-d, L. monocytogenesATCC 15313, Micrococcus luteus?CIP 5345, S. aureus?CIP 677, S. aureusLMA, S. epidermidisCIP 53134, E. coli?CIP 548, E. coliL?, Enterobacter cloacae?CIP 6085, Klebsiella pneumoniae?CIP 8291, Proteus mirabilisLMA TP, Salmonella enterica?CIP 813, Serratia marcescens?LMA TP, Yersinia entericolitica?CIP 6529, Alcaligenes faecalis?CIP 6723, Flavobacterium meningosepticumCIP 6057, Pseudomonas aeruginosa?CIP A22, P. putidaLMA, Saccharomyces cerevisiae?LMA 720 |
| Validated : |
Experimentally Validated |
| Pfam : |
PF07442 : ( Ponericin )
|
| InterPro : |
IPR010002 : Ponericin.
|
| AMP Family : |
Ponericin |
| Signature : |
| ID |
Type |
Pattern / HMM |
T. Length |
|
CAMPPonH |
HMM |
 |
Variable |
|
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0005576 |
Cellular Component |
Extracellular region |
IEA |
| GO:0042742 |
Biological Process |
Defense response to bacterium |
IEA |
| GO:0050832 |
Biological Process |
Defense response to fungus |
IEA |
| GO:0031640 |
Biological Process |
Killing of cells of other organism |
IEA |
|
Sequence: |
GWKDWAKKAGGWLKKKGPGMAKAALKAAMQ |