CAMPSQ2236
Title : Cathelicidin antimicrobial peptide
GenInfo Identifier : 158262001
Source : Rattus norvegicus [Rat]
Taxonomy : Animalia, Mammals
UniProt: G3V8S9
Length : 175
Activity : Antimicrobial
Validated : Predicted
Pfam : PF12153 : ( LPS binding domain of CAP18 (C terminal) )
PF00666 : ( Cathelicidin )
InterPro : IPR001894 : Cathelicidin.
IPR018216 : Cathelicidin_CS.
IPR022746 : Cathlecidin_C.
IPR000010 : Prot_inh_cystat.
AMP Family : Cathelicidin
Signature :
ID Type Pattern / HMM T. Length
CAMPCatH HMM Variable
CAMPCatH37 HMM 37
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0042995 Cellular Component Cell projection IDA
GO:0005737 Cellular Component Cytoplasm IDA
GO:0005615 Cellular Component Extracellular space IDA
GO:0042581 Cellular Component Specific granule IEA
GO:0004869 Molecular Function Cysteine-type endopeptidase inhibitor activity IEA
GO:0071347 Biological Process Cellular response to interleukin-1 IEP
GO:0071354 Biological Process Cellular response to interleukin-6 IEP
GO:0071222 Biological Process Cellular response to lipopolysaccharide IEP
GO:0071224 Biological Process Cellular response to peptidoglycan IEP
GO:0071356 Biological Process Cellular response to tumor necrosis factor IEP
GO:0050829 Biological Process Defense response to Gram-negative bacterium IMP
GO:0050830 Biological Process Defense response to Gram-positive bacterium IMP
GO:0051873 Biological Process Killing by host of symbiont cells IEA
GO:0044130 Biological Process Negative regulation of growth of symbiont in host IEA
GO:0044140 Biological Process Negative regulation of growth of symbiont on or near host surface IEA
GO:0045766 Biological Process Positive regulation of angiogenesis IMP
GO:0008284 Biological Process Positive regulation of cell proliferation IMP
GO:0001934 Biological Process Positive regulation of protein phosphorylation IMP
Sequence:
 MQPHRDVPSLWRSLSLLLLLGLGLPLAVSQTLSYREAVLRAVDDFNQQSLDTNLYRLLDL
DSEPQGDEDPDTPKYVRFRVKETVCSKASQQLPEQCAFKEQGVVKQCMGTVTLNQAAESF
DISCDAPGIQPFRFKKISRLAGLLRKGGEKFGEKLRKIGQKIKDFFQKLAPEIEQ