| CAMPSQ462 |
| Title : |
Bacteriocin lactacin-F subunit lafA precursor |
| GenInfo Identifier : |
45644956 |
| Source : |
Lactobacillus johnsonii |
| Taxonomy : |
Bacteria |
| UniProt: |
P24022 |
| PubMed : |
1903624 |
| Length : |
57 |
| Activity : |
Antibacterial |
| Gram Nature : |
Gram+ve |
| Target : |
Enterococcus faecalis, other lactobacilli |
| Validated : |
Experimentally Validated |
| Pfam : |
PF10439 : ( Bacteriocin class II with double-glycine leader peptide )
|
| InterPro : |
IPR019493 : Bacteriocin_IIb_lactacin-rel.
|
| AMP Family : |
Bacteriocin |
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0019835 |
Biological Process |
Cytolysis |
IEA |
| GO:0042742 |
Biological Process |
Defense response to bacterium |
IEA |
|
Sequence: |
RNNWQTNVGGAVGSAMIGATVGGTICGPACAVAGAHYLPILWTAVTAATGGFGKIRK |
