| CAMPSQ475 |
| Title : |
Bacteriocin amylovorin-L |
| GenInfo Identifier : |
46397849 |
| Source : |
Lactobacillus amylovorus |
| Taxonomy : |
Bacteria |
| UniProt: |
P80696 |
| PubMed : |
10517609 |
| Length : |
50 |
| Activity : |
Antibacterial |
| Gram Nature : |
Gram+ve |
| Target : |
Lactobacillus acidophilus LMG 9433, Lactobacillus delbrueckii subsp. bulgaricus LMG 6901, Lactobacillus delbrueckii subsp. lactis LMG 7942 |
| Validated : |
Experimentally Validated |
| Comment : |
Inactive against Clostridium sporogenes LMG 13570, Clostridium tyrobutyricum LMG 1285, Clostridium tyrobutyricum LMG 13571, Enterococcus faecium CCM 4231, Enterococcus faecium RZS C13, Lactobacillus amylovorus LMG P-13139, Lactobacillus amylovorus DCE 471 |
| Pfam : |
PF10439 : ( Bacteriocin class II with double-glycine leader peptide )
|
| InterPro : |
IPR019493 : Bacteriocin_IIb_lactacin-rel.
IPR010133 : Bacteriocin_signal_seq.
|
| AMP Family : |
Bacteriocin |
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0020002 |
Cellular Component |
Host cell plasma membrane |
IEA |
| GO:0016021 |
Cellular Component |
Integral to membrane |
IEA |
| GO:0019835 |
Biological Process |
Cytolysis |
IEA |
| GO:0042742 |
Biological Process |
Defense response to bacterium |
IEA |
|
Sequence: |
NRWTNAYSAALGCAVPGVKYGKKLGGVWGAVIGGVGGAAVCGLAGYVRKG |