| CAMPSQ537 |
| Title : |
Defensin |
| GenInfo Identifier : |
585042 |
| Source : |
Pyrrhocoris apterus [Sap sucking bug] |
| Taxonomy : |
Animalia, Insects |
| UniProt: |
P37364 |
| PubMed : |
8002963 |
| Length : |
43 |
| Activity : |
Antibacterial |
| Gram Nature : |
Gram+ve, Gram-ve |
| Target : |
M.luteus, B.megaterium, A.viridans, S.aureus and S.saprophyticus, P.acidilactici, B.subtilis QB935, E.coli D22 |
| Validated : |
Experimentally Validated |
| Pfam : |
PF01097 : ( Arthropod defensin )
|
| InterPro : |
IPR001542 : Defensin_invertebrate/fungal.
IPR003614 : Scorpion_toxin-like.
|
| AMP Family : |
Defensin |
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0005576 |
Cellular Component |
Extracellular region |
IEA |
| GO:0042742 |
Biological Process |
Defense response to bacterium |
IEA |
| GO:0045087 |
Biological Process |
Innate immune response |
IEA |
|
Sequence: |
ATCDILSFQSQWVTPNHAGCALHCVIKGYKGGQCKITVCHCRR |
