| CAMPSQ850 |
| Title : |
Dermaseptin-3 |
| GenInfo Identifier : |
29337224 |
| Source : |
Phyllomedusa bicolor [Two-colored leaf frog] |
| Taxonomy : |
Animalia, Amphibians |
| UniProt: |
P81488 |
| PubMed : |
9540838 |
| Length : |
30 |
| Activity : |
Antibacterial |
| Gram Nature : |
Gram+ve, Gram-ve |
| Target : |
mollicutes ( MIC = 6.25 to 100 microM), firmicutes ( MIC = 6.25 to 100 microM), gracilicutes ( MIC = 6.25 to 100 microM) |
| Validated : |
Experimentally Validated |
| Pfam : |
PF03032 : ( Brevenin/esculentin/gaegurin/rugosin family )
|
| InterPro : |
IPR004275 : Brevinin.
|
| AMP Family : |
Dermaseptin |
| Signature : |
| ID |
Type |
Pattern / HMM |
T. Length |
|
CAMPDerP30 |
Pattern |
L-[FW]-K-[NT]-[ILM]-[IL]-K-G-[AI]-G-K-[LMV]-x-G-x(1,2)-A-x(1,3)-L-G-[AS]-x(3)-[LP]-x-[GS] |
30 |
|
CAMPDerH30 |
HMM |
 |
30 |
|
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0005576 |
Cellular Component |
Extracellular region |
IEA |
| GO:0042742 |
Biological Process |
Defense response to bacterium |
IEA |
|
Sequence: |
ALWKTIIKGAGKMIGSLAKNLLGSQAQPES |
