| CAMPSQ854 |
| Title : |
Myticin-A |
| GenInfo Identifier : |
6647599 |
| Source : |
Mytilus galloprovincialis [Mediterranean mussel] |
| Taxonomy : |
Animalia, Molluscs (Bivalvia) |
| UniProt: |
P82103 |
| PubMed : |
10491159 |
| Length : |
40 |
| Activity : |
Antibacterial |
| Gram Nature : |
Gram+ve |
| Target : |
Micrococcus luteus ( MIC = 2.25-4.5 microM) , Bacillus megaterium ( MIC = 2.25-4.5 microM) , Staphylococcus aureus ( MIC = >20 microM) , Listeria monocytogenes ( MIC = >20 microM) , Enterococcus viridans ( MIC = 9-4.5 microM) , Enterococcus faecalis ( MIC => 20 microM) , Escherichia coli D31 ( MIC => 20 microM) , Salmonella newport ( MIC => 20 microM) , Salmonella typhimurium ( MIC => 20 microM) , Brucella suis ( MIC => 20 microM) , Pseudomonas aeruginosa ( MIC => 20 microM) , Enteromonas aerogenes ( MIC => 20 microM) , Vibrio alginolyticus ( MIC => 20 microM) , Vibrio vulnificus ( MIC => 20 microM) , Vibrio splendidus ( MIC => 20 microM) , Fusarium oxysporum ( MIC => 20 microM) , Perkinsus marinus ( MIC => 20 microM) |
| Validated : |
Experimentally Validated |
| Pfam : |
PF10690 : ( Myticin pre-proprotein from the mussel )
|
| InterPro : |
IPR019631 : Myticin_preproprotein.
|
| AMP Family : |
Myticin |
| Signature : |
| ID |
Type |
Pattern / HMM |
T. Length |
|
CAMPMytP |
Pattern |
C-T-S-Y-[WY]-C-[GS]-K-F-C-G-[ST]-A-[GS]-C-[ST]-x-Y-[GL]-C-x(2)-L-H-x-G-K-[ILM]-C-x-C-[LV]-H-C-S-R |
Variable |
|
CAMPMytH |
HMM |
 |
Variable |
|
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0005576 |
Cellular Component |
Extracellular region |
IEA |
| GO:0042742 |
Biological Process |
Defense response to bacterium |
IEA |
|
Sequence: |
HSHACTSYWCGKFCGTASCTHYLCRVLHPGKMCACVHCSR |
