CAMPSQ857
Title : Fabatin-2
GenInfo Identifier : 3913646
Source : Vicia faba [Broad bean]
Taxonomy : Viridiplantae
UniProt: P81457
PubMed : 9103978
Length : 47
Activity : Antibacterial
Gram Nature : Gram+ve, Gram-ve
Target : P.aeruginosa
Validated : Experimentally Validated
Comment : Inactive against S.cerevisiae and C.albicans
Pfam : PF00304 : ( Gamma-thionin family )
InterPro : IPR008177 : G_Purothionin.
IPR008176 : Gamma-thionin.
IPR003614 : Scorpion_toxin-like.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0042742 Biological Process Defense response to bacterium IEA
GO:0050832 Biological Process Defense response to fungus IEA
GO:0031640 Biological Process Killing of cells of other organism IEA
Sequence:
 LLGRCKVKSNRFNGPCLTDTHCSTVCRGEGYKGGDCHGLRRRCMCLC