| CAMPSQ912 |
| Title : |
Cysteine-rich antifungal protein 1 (At-AFP1) |
| GenInfo Identifier : |
3915600 |
| Source : |
Arabidopsis thaliana [Mouse-ear cress] |
| Taxonomy : |
Viridiplantae |
| UniProt: |
P30224 |
| PubMed : |
8422949 |
| Length : |
51 |
| Activity : |
Antifungal |
| Target : |
Alternaria brassicola ( IC50 = 10 microg/ml) , Botrytis cinerea ( IC50 = 3.90 microg/ml) , Fusarium culmorum ( IC50 = 3 microg/ml) , Fusarium oxysporum f.sp.lycopersici ( IC50 = 3 microg/ml) , Pyricularia oryzae ( IC50 = 0.25 microg/ml) , Verticiliium dahliae ( IC50 = 1.50 microg/ml) |
| Validated : |
Experimentally Validated |
| Pfam : |
PF00304 : ( Gamma-thionin family )
|
| InterPro : |
IPR008176 : Gamma-thionin.
IPR003614 : Scorpion_toxin-like.
|
| AMP Family : |
Defensin |
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0005576 |
Cellular Component |
Extracellular region |
IEA |
| GO:0006952 |
Biological Process |
Defense response |
ISS |
| GO:0050832 |
Biological Process |
Defense response to fungus |
IEA |
| GO:0031640 |
Biological Process |
Killing of cells of other organism |
IEA |
|
Sequence: |
QKLCERPSGTWSGVCGNSNACKNQCINLEKARHGSCNYVFPAHKCICYFPC |