| CAMPSQ980 |
| Title : |
Cathelin-related antimicrobial peptide |
| GenInfo Identifier : |
1706115 |
| Source : |
Mus musculus [Mouse] |
| Taxonomy : |
Animalia, Mammals |
| UniProt: |
P51437 |
| PubMed : |
9148921 |
| Length : |
33 |
| Activity : |
Antibacterial |
| Gram Nature : |
Gram+ve, Gram-ve |
| Target : |
Escherichia coli ATCC 25922 (MIC = 1microM), Escherichia coli ML35 (MIC = 2microM), Escherichia coli D21 (MIC = 8microM), Pseudomonas aeruginosa ATCC 27853 (MIC = 4microM), Serratia marcescens ATCC 8100 (MIC = 4microM), Staphylococcus aureus ATCC 25923 (MIC = 32microM), Staphylococcus aureus Cowan I (MIC = 32microM), Staphylococcus aureus (MRSA) (MIC > 64 microM), Staphylococcus aureus MRSA (MIC = 64 microM), Staphylococcus epidermidis ATCC 12228 (MIC = 16 microM) , Streptococcus faecalis ATCC 29212 (MIC = 32 microM) , Bacillus megaterium Bm11 (MIC = 4 microM) , Candida albicans (MIC > 64 microM) , Cryptococcus neoformans (MIC = 16 microM) |
| Validated : |
Experimentally Validated |
| Pfam : |
PF12153 : ( LPS binding domain of CAP18 (C terminal) )
PF00666 : ( Cathelicidin )
|
| InterPro : |
IPR001894 : Cathelicidin.
IPR018216 : Cathelicidin_CS.
IPR022746 : Cathlecidin_C.
|
| AMP Family : |
Cathelicidin |
| Signature : |
| ID |
Type |
Pattern / HMM |
T. Length |
|
CAMPCatH |
HMM |
 |
Variable |
|
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0005576 |
Cellular Component |
Extracellular region |
IEA |
| GO:0042581 |
Cellular Component |
Specific granule |
IDA |
| GO:0050829 |
Biological Process |
Defense response to Gram-negative bacterium |
IDA |
| GO:0050830 |
Biological Process |
Defense response to Gram-positive bacterium |
IMP |
| GO:0051873 |
Biological Process |
Killing by host of symbiont cells |
IMP |
| GO:0044130 |
Biological Process |
Negative regulation of growth of symbiont in host |
IMP |
| GO:0044140 |
Biological Process |
Negative regulation of growth of symbiont on or near host surface |
IMP |
|
Sequence: |
GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE |