CAMPSQ1053
Title : Neutrophil cationic peptide 1
GenInfo Identifier : 399355
Source : Cavia porcellus [Guinea pig]
Taxonomy : Animalia, Mammals
UniProt: P11478, Q64365
PubMed : 2473036 , 3623703
Length : 31
Activity : Antibacterial, Antifungal, Antiviral
Gram Nature : Gram+ve, Gram-ve
Target : [ Refer 2473036 :S. aureus, E. coli ] , [ Refer 3623703: P. aeruginosa , Streptococcus , C.albicans , HSV-1 ]
Validated : Experimentally Validated
Pfam : PF00323 : ( Mammalian defensin )
PF00879 : ( Defensin propeptide )
InterPro : IPR016327 : Alpha-defensin.
IPR006080 : Defensin_beta/neutrophil.
IPR002366 : Defensin_propep.
IPR006081 : Mammalian_defensins.
Signature :
ID Type Pattern / HMM T. Length
CAMPDefP30 Pattern C-x(4)-C-x(4)-R-[QR]-x-G-T-C-[FIL] 30
CAMPDefH30 HMM 30
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular Component Extracellular space IEA
GO:0042742 Biological Process Defense response to bacterium IEA
GO:0050832 Biological Process Defense response to fungus IEA
GO:0051607 Biological Process Defense response to virus IEA
GO:0031640 Biological Process Killing of cells of other organism IEA
GO:0005615 Cellular Component Extracellular space IEA
GO:0042742 Biological Process Defense response to bacterium IEA
GO:0050832 Biological Process Defense response to fungus IEA
GO:0051607 Biological Process Defense response to virus IEA
GO:0031640 Biological Process Killing of cells of other organism IEA
Sequence:
 RRCICTTRTCRFPYRRLGTCIFQNRVYTFCC