CAMPSQ1118
Title : Thaumatin-like protein
GenInfo Identifier : 68064400
Source : Phaseolus vulgaris [Kidney bean]
Taxonomy : Viridiplantae
UniProt: P83959
PubMed : 10486265
Length : 30
Activity : Antifungal
Target : C.comatus, F.oxysporum, P.ostreatus
Validated : Experimentally Validated
InterPro : IPR001938 : Thaumatin.
AMP Family : Thaumatin
Signature :
ID Type Pattern / HMM T. Length
CAMPThaP Pattern A-x-[FI]-[ENT]-[FIV]-x-N-x(2)-[PQST]-x-T-[IV]-W-[AP] Variable
CAMPThaH HMM Variable
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IEA
GO:0050832 Biological Process Defense response to fungus IEA
GO:0031640 Biological Process Killing of cells of other organism IEA
Sequence:
ANFEIVNNCPYTVWAAASPGGGRRLDRGQT