CAMPSQ1240
Title : Penaeidin-3n
GenInfo Identifier : 25090978
Source : Litopenaeus setiferus [Atlantic white shrimp]
Taxonomy : Animalia, Crustaceans (Malacostraca)
UniProt: Q962B0
Length : 55
Activity : Antibacterial, Antifungal
Validated : Predicted
Pfam : PF05927 : ( Penaeidin )
InterPro : IPR009226 : Penaeidin.
AMP Family : Penaeidin
Signature :
ID Type Pattern / HMM T. Length
CAMPPenH HMM Variable
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005737 Cellular Component Cytoplasm IEA
GO:0008061 Molecular Function Chitin binding IEA
GO:0042742 Biological Process Defense response to bacterium IEA
GO:0050832 Biological Process Defense response to fungus IEA
GO:0031640 Biological Process Killing of cells of other organism IEA
Sequence:
QGYKGPYTRPILRPYVRPVVSYNACTLSCRGITTTQARSCSTRLGRCCHVAKGYS