CAMPSQ1331
Title : Gal 9
GenInfo Identifier : 113911517
Source : Gallus gallus [Chicken]
Taxonomy : Animalia, Aves
UniProt: Q6QLR1
Length : 36
Activity : Antimicrobial
Validated : Experimentally Validated
Pfam : PF00711 : ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
AMP Family : Defensin
Signature :
ID Type Pattern / HMM T. Length
CAMPDefH HMM Variable
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IEA
GO:0042742 Biological Process Defense response to bacterium IEA
GO:0050832 Biological Process Defense response to fungus IEA
GO:0031640 Biological Process Killing of cells of other organism IEA
Sequence:
DTLACRQSHGSCSFVACRAPSVDIGTCRGGKLKCCK