CAMPSQ1555
Title : Andropin
GenInfo Identifier : 25089619
Source : Drosophila simulans [Fruit fly]
Taxonomy : Animalia, Insects
UniProt: Q8WSV4
Length : 37
Activity : Antibacterial
Gram Nature : Gram+ve
Validated : Predicted
Pfam : PF00272 : ( Cecropin family )
InterPro : IPR000875 : Cecropin.
Signature :
ID Type Pattern / HMM T. Length
CAMPCecH HMM Variable
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region ISS
GO:0045087 Biological Process Innate immune response IEA
GO:0006962 Biological Process Male-specific antibacterial humoral response ISS
GO:0006965 Biological Process Positive regulation of biosynthetic process of antibacterial peptides active against Gram-positive bacteria ISS
Sequence:
VFIDILDKMENAIHKAAQAGIGIAKPIENMILPKLTK