CAMPSQ162
Title : Defensin
GenInfo Identifier : 156630495
Source : Galleria mellonella [Greater wax moth]
Taxonomy : Animalia, Insects
UniProt: P85213
PubMed : 17194500
Length : 44
Activity : Antifungal
Target : P. pastoris ( MIC = 8.3-16.5 microM ), Z. marxianus ( MIC = 8.3-16.5 microM ), S. pombe ( MIC = 5.5-11 microM ), C. wickerhamii ( MIC = 8.3-16.5 microM )
Validated : Experimentally Validated
Comment : Inactive against M.luteus, L.monocytogenes, S.aureus, S.lutea, E.coli D31, E. coli ATCC 25922, S. typhimurium, , S.cerevisiae.
InterPro : IPR001542 : Defensin_invertebrate/fungal.
IPR003614 : Scorpion_toxin-like.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular Component Extracellular space IDA
GO:0050832 Biological Process Defense response to fungus IDA
GO:0045087 Biological Process Innate immune response IDA
GO:0031640 Biological Process Killing of cells of other organism IEA
Sequence:
DTLIGSCVWGATNYTSDCNAECKRRGYKGGHCGSFLNVNCWCEE