CAMPSQ1654
Title : Cysteine-rich antifungal protein 4
GenInfo Identifier : 11386627
Source : Raphanus sativus [Radish]
Taxonomy : Viridiplantae
UniProt: O24331
PubMed : 7780308
Length : 48
Activity : Antifungal
Target : A. brassicola ( MIC = 5 microg/ml) , Botrytis cinerea ( MIC = 9 microg/ml) , F. culmorum ( MIC = 11 microg/ml)
Validated : Experimentally Validated
Pfam : PF00304 : ( Gamma-thionin family )
InterPro : IPR008176 : Gamma-thionin.
IPR003614 : Scorpion_toxin-like.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IEA
GO:0050832 Biological Process Defense response to fungus IEA
GO:0031640 Biological Process Killing of cells of other organism IEA
Sequence:
QKLCERSSGTWSGVCGNNNACKNQCINLEGARHGSCNYIFPYHRCICY