CAMPSQ194
Title : Dermaseptin B2
GenInfo Identifier : 1706455
Source : Phyllomedusa bicolor [Two-colored leaf frog]
Taxonomy : Animalia, Amphibians
NCBI Taxonomy : 8393
UniProt: P80282
PubMed : 8306981
Length : 31
Activity : Antibacterial, Antifungal
Gram Nature : Gram+ve, Gram-ve
Validated : Experimentally Validated
Comment : Microsporum canis (IP 1194)(10microg/ml), Tricophyton rubrum (IP 1400-82)(15microg/ml), Arthroderma simii (IP 1063-74)(30microg/ml), Aspergillus fumigatus (IP 1025-70)(
Pfam : PF03032 : ( Brevenin/esculentin/gaegurin/rugosin family )
PF12121 : ( Dermaseptin )
InterPro : IPR004275 : Brevinin.
IPR022731 : Dermaseptin.
AMP Family : Dermaseptin
Signature :
ID Type Pattern / HMM T. Length
CAMPDerH HMM Variable
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IEA
GO:0042742 Biological Process Defense response to bacterium IEA
GO:0050832 Biological Process Defense response to fungus IEA
GO:0031640 Biological Process Killing of cells of other organism IEA
Sequence:
AMWKDVLKKIGTVALHAGKAALGAVADTISQ