CAMPSQ211
Title : Ponericin-G2
GenInfo Identifier : 18202398
Source : Pachycondyla goeldii [Ponerine ant]
Taxonomy : Animalia, Insects
UniProt: P82415
PubMed : 11279030
Length : 30
Activity : Antibacterial, Antifungal
Gram Nature : Gram+ve, Gram-ve
Target : Saccharomyces cerevisae
Validated : Experimentally Validated
Pfam : PF07442 : ( Ponericin )
InterPro : IPR010002 : Ponericin.
AMP Family : Ponericin
Signature :
ID Type Pattern / HMM T. Length
CAMPPonH HMM Variable
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IEA
GO:0042742 Biological Process Defense response to bacterium IEA
GO:0050832 Biological Process Defense response to fungus IEA
GO:0031640 Biological Process Killing of cells of other organism IEA
Sequence:
GWKDWLKKGKEWLKAKGPGIVKAALQAATQ