CAMPSQ2358
Title : Cathelicidin antimicrobial peptide precursor
GenInfo Identifier : 290543346
Source : Cavia porcellus [Guinea pig]
Taxonomy : Animalia, Mammals
UniProt: Q91X12
PubMed : 9278433
Length : 42
Activity : Antibacterial
Gram Nature : Gram+ve, Gram-ve
Validated : Predicted
Pfam : PF00666 : ( Cathelicidin )
InterPro : IPR001894 : Cathelicidin.
IPR018216 : Cathelicidin_CS.
AMP Family : Cathelicidin
Signature :
ID Type Pattern / HMM T. Length
CAMPCatH HMM Variable
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IEA
GO:0042581 Cellular Component Specific granule IEA
GO:0050829 Biological Process Defense response to Gram-negative bacterium IEA
GO:0050830 Biological Process Defense response to Gram-positive bacterium IEA
GO:0051873 Biological Process Killing by host of symbiont cells IEA
GO:0044130 Biological Process Negative regulation of growth of symbiont in host IEA
GO:0044140 Biological Process Negative regulation of growth of symbiont on or near host surface IEA
Sequence:
LRKKFRKTRKRIQKLGRKIGKTGRKVWKAWREYGQIPYPCRI