CAMPSQ2437
Title : Cathelin-related antimicrobial peptide
GenInfo Identifier : 344236040
Source : Cricetulus griseus [Chinese hamster]
Taxonomy : Animalia, Mammals
NCBI Taxonomy : 10029
UniProt: G3HKQ4
Length : 65
Activity : Antimicrobial
Validated : Predicted
Comment : Unpublished
Pfam : PF00666 : ( Cathelicidin )
InterPro : IPR001894 : Cathelicidin.
IPR018216 : Cathelicidin_CS.
AMP Family : Cathelicidin
Signature :
ID Type Pattern / HMM T. Length
CAMPCatH HMM Variable
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IEA
GO:0006952 Biological Process Defense response IEA
Sequence:
FRYREAVLRAVDNFNQQSSDPNLYRFLDMDSQPPGDEDSDSPMYVNFRIKETVCEKTTYQ
IPEQC