CAMPSQ2619
Title : Esculentin-2N protein precursor, partial
GenInfo Identifier : 343952449
Source : Pelophylax nigromaculatus [Black-spotted frog]
Taxonomy : Animalia, Amphibians
UniProt: G3E7S7, G3E7S5, G3E7S3, G3E7S0, G3E7R7, G3E7S8, G3E7S6, G3E7S4, G3E7R8
Length : 36
Activity : Antimicrobial
Validated : Predicted
Comment : Unpublished
Pfam : PF08023 : ( Frog antimicrobial peptide )
PF03032 : ( Brevenin/esculentin/gaegurin/rugosin family )
InterPro : IPR012521 : Antimicrobial_frog_2.
IPR004275 : Brevinin.
AMP Family : Esculentin
Signature :
ID Type Pattern / HMM T. Length
CAMPEscP37 Pattern K-x(2)-[AGT]-[KR]-x-G-x(3)-[ILMV]-[AGS]-C-K-[AIV]-x(2)-[EQ]-C 37
CAMPEscH HMM Variable
CAMPEscH37 HMM 37
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IEA
GO:0042742 Biological Process Defense response to bacterium IEA
GO:0005576 Cellular Component Extracellular region IEA
GO:0042742 Biological Process Defense response to bacterium IEA
GO:0005576 Cellular Component Extracellular region IEA
GO:0042742 Biological Process Defense response to bacterium IEA
GO:0005576 Cellular Component Extracellular region IEA
GO:0042742 Biological Process Defense response to bacterium IEA
GO:0005576 Cellular Component Extracellular region IEA
GO:0042742 Biological Process Defense response to bacterium IEA
GO:0005576 Cellular Component Extracellular region IEA
GO:0042742 Biological Process Defense response to bacterium IEA
GO:0005576 Cellular Component Extracellular region IEA
GO:0042742 Biological Process Defense response to bacterium IEA
GO:0005576 Cellular Component Extracellular region IEA
GO:0042742 Biological Process Defense response to bacterium IEA
GO:0005576 Cellular Component Extracellular region IEA
GO:0042742 Biological Process Defense response to bacterium IEA
Sequence:
 IFSLIKGAAKVVAKGLGKEVGKFGLDLMACKVTNQC