CAMPSQ3328 |
Title : |
Duck AvBD9 |
Source : |
Anas platyrhynchos [Domestic duck] |
Taxonomy : |
Animalia, Aves |
PubMed : |
Reference: Liao W, Ma D, Wang R, Han Z, Shao T, Li H, Liu S (2009) mRNA Cloning, Evolutionary Analysis and Biological Characterization of Duck Avian Beta-defensin 10. Acta Veterinaria et Zootechnica Sinica, 2009, 40(9): 1320-1326.
|
Length : |
42 |
Activity : |
Antibacterial |
Gram Nature : |
Gram+ve, Gram-ve |
Target : |
Escherichia coli, Lactobacilli acidophilus, Bacillus subtilis, Staphylococcus aureus, Pasteurella multocida. |
Validated : |
Experimentally Validated |
AMP Family : |
Defensin |
Sequence: |
ADTLACRQSHQSCSFVACRAPSVDIGTCRGGKLKCCKWAPSS |