CAMPSQ343
Title : Penaeidin-2a
GenInfo Identifier : 3024356
Source : Litopenaeus vannamei [Whiteleg shrimp]
Taxonomy : Animalia, Crustaceans (Malacostraca)
UniProt: P81057
PubMed : 11028917
Length : 50
Activity : Antibacterial, Antifungal
Gram Nature : Gram+ve, Gram-ve
Target : Micrococcus luteus, Escherichia coli 363, Fusarium Oxysporum, Saccharomyces cerevisiae TGY
Validated : Experimentally Validated
Pfam : PF05927 : ( Penaeidin )
InterPro : IPR009226 : Penaeidin.
AMP Family : Penaeidin
Signature :
ID Type Pattern / HMM T. Length
CAMPPenP Pattern G-[HY]-T-x-P-x(1,3)-P-x(0,1)-R-P-[ILP]-x(4)-[IP]-[GILP]-x(3)-[CPV]-x-[CGNT] Variable
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005737 Cellular Component Cytoplasm IEA
GO:0008061 Molecular Function Chitin binding IEA
GO:0042742 Biological Process Defense response to bacterium IEA
GO:0050832 Biological Process Defense response to fungus IEA
GO:0031640 Biological Process Killing of cells of other organism IEA
Sequence:
YRGGYTGPIPRPPPIGRPPFRPVCNACYRLSVSDARNCCIKFGSCCHLVK