CAMPSQ385
Title : Defensin
GenInfo Identifier : 3913449
Source : Bombus pascuorum [Brown bumblebee]
Taxonomy : Animalia, Insects
UniProt: P81462
PubMed : 9219367
Length : 51
Activity : Antibacterial, Antifungal
Gram Nature : Gram+ve, Gram-ve
Target : M. luteus, E. coli D22
Validated : Experimentally Validated
Pfam : PF01097 : ( Arthropod defensin )
InterPro : IPR017982 : Defensin_insect.
IPR001542 : Defensin_invertebrate/fungal.
IPR003614 : Scorpion_toxin-like.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IEA
GO:0042742 Biological Process Defense response to bacterium IEA
GO:0050832 Biological Process Defense response to fungus IEA
GO:0045087 Biological Process Innate immune response IEA
GO:0031640 Biological Process Killing of cells of other organism IEA
Sequence:
VTCDLLSIKGVAEHSACAANCLSMGKAGGRCENGICLCRKTTFKELWDKRF