CAMPSQ3877
Title : Defensin-1
Source : Crassostrea virginica [Eastern oyster]
Taxonomy : Animalia, Molluscs (Bivalvia)
UniProt: P85008
PubMed : 16297885
Length : 38
Activity : Antibacterial
Gram Nature : Gram+ve, Gram-ve
Target : Lactococcus lactis subsp. lactis ( Minimum effective concentrations ( MECs = 2.4 microg/ml ), Staphylococcus aureus ( MECs = 3.0 microg/ml ), Escherichia coli D31 ( MECs = 7.6 microg/ml ), Vibrio parahemolyticus ( MECs = 15.0 microg/ml )
Validated : Experimentally Validated
Pfam : PF01097 : ( Arthropod defensin )
InterPro : IPR001542 : Defensin_invertebrate/fungal.
IPR003614 : Scorpion_toxin-like.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0050829 Biological Process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological Process Defense response to Gram-positive bacterium IDA
GO:0045087 Biological Process Innate immune response IDA
Sequence:
GFGCPWNRYQCHSHCRSIGRLGGYCAGSLRLTCTCYRS