| CAMPSQ3909 |
| Title : |
Microcin E492 |
| Source : |
Klebsiella pneumoniae |
| Taxonomy : |
Bacteria |
| UniProt: |
Q9Z4N4 |
| PubMed : |
15102848 |
| Length : |
84 |
| Activity : |
Antibacterial |
| Gram Nature : |
Gram-ve |
| Target : |
Eschericia coli B ( MIC = 0.30 microM ), Eschericia coli F ( MIC = 0.30 microM ), Eschericia coli ML35p ( MIC = 0.30 microM ), Salmonella enteritidis ( MIC = 1.25 microM ) |
| Validated : |
Experimentally Validated |
| Comment : |
Inactive against Enterobacter cloacae, Klebsiella pneumoniae, Vibrio alginolyticus, Vibrio harveyi, Vibrio penaeicida, Micrococcus luteus CIP5345, Staphylococcus aureus, Staphylococcus haemolyticus, Bacillus megaterium in the range of 0.02-10 micoM |
| AMP Family : |
Bacteriocin |
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0019835 |
Biological Process |
Cytolysis |
IEA |
| GO:0042742 |
Biological Process |
Defense response to bacterium |
IEA |
| GO:0006811 |
Biological Process |
Ion transport |
IEA |
|
Sequence: |
GETDPNTQLLNDLGNNMAWGAALGAPGGLGSAALGAAGGALQTVGQGLIDHGPVNVPIPV
LIGPSWNGSGSGYNSATSSSGSGS |
