CAMPSQ3970
Title : Defensin-1
Source : Pinus sylvestris [Scots pine]
Taxonomy : Viridiplantae
NCBI Taxonomy : 3349
UniProt: A4L7R7
PubMed : 19683554
Length : 50
Activity : Antifungal
Target : Botrytis cinera ( IC50 = 0.4 microg/ml ), Fusarium oxysporum ( IC50 = 2.9 microg/ml ), Fusarium solani ( IC50 = 0.9 microg/ml ), Heterobasidion annosum ( IC50 = 1.4 microg/ml ), Candida albicans,Trichoderma reesei
Validated : Experimentally Validated
Comment : Inactive against Escherichia coli, Erwinia carotovora
Pfam : PF00304 : ( Gamma-thionin family )
InterPro : IPR008177 : G_Purothionin.
IPR008176 : Gamma-thionin.
IPR003614 : Scorpion_toxin-like.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IDA
GO:0050832 Biological Process Defense response to fungus IDA
GO:0031640 Biological Process Killing of cells of other organism IEA
Sequence:
RMCKTPSGKFKGYCVNNTNCKNVCRTEGFPTGSCDFHVAGRKCYCYKPCP