| CAMPSQ4343 |
| Title : |
Defensin D1 |
| Source : |
Nigella sativa [Black cumin] |
| Taxonomy : |
Viridiplantae |
| UniProt: |
P86972 |
| PubMed : |
21144761 |
| Length : |
50 |
| Activity : |
Antibacterial, Antifungal |
| Gram Nature : |
Gram+ve, Gram-ve |
| Target : |
Aspergillus niger ( IC50 = 3.5 microg/ml ), Bipolaris sorokiniana ( IC 50 = 3.0 microg/ml ), Fusarium oxysporum ( IC50 = 9.5 microg/ml ), Fusarium graminearum ( IC 50 = 6.9 microg/ml ), Fusarium culmorum ( IC 50 = 6.9 microg/ml ), Botrytis cinerea ( IC 50 = 27.4 microg/ml ), Phytophthora infestans ( IC50 13.6 microg/ml ) , Clavibacter michiganensis, Bacillus subtilis, Pseudomonas syringae, Erwinia carotovora, Escherichia coli |
| Validated : |
Experimentally Validated |
| Pfam : |
PF00304 : ( Gamma-thionin family )
|
| InterPro : |
IPR008176 : Gamma-thionin.
IPR003614 : Scorpion_toxin-like.
|
| AMP Family : |
Defensin |
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0005576 |
Cellular Component |
Extracellular region |
IEA |
| GO:0050832 |
Biological Process |
Defense response to fungus |
IDA |
| GO:0050829 |
Biological Process |
Defense response to Gram-negative bacterium |
IDA |
| GO:0050830 |
Biological Process |
Defense response to Gram-positive bacterium |
IDA |
| GO:0031640 |
Biological Process |
Killing of cells of other organism |
IDA |
|
Sequence: |
KFCEKPSGTWSGVCGNSGACKDQCIRLEGAKHGSCNYKPPAHRCICYYEC |
