CAMPSQ4344
Title : Defensin D2
Source : Nigella sativa [Black cumin]
Taxonomy : Viridiplantae
UniProt: P86973
PubMed : 21144761
Length : 50
Activity : Antibacterial, Antifungal
Gram Nature : Gram+ve, Gram-ve
Target : Aspergillus niger ( IC 50 = 3.5 microg/ml ), Bipolaris sorokiniana ( IC 50 = 1.8 microg/ml ), Fusarium oxysporum ( IC 50 = 5.3 microg/ml ), Fusarium graminearum ( IC 50 = 6.9 microg/ml ), Fusarium culmorum ( IC 50 = 6.9 microg/ml ), Botrytis cinerea ( IC 50 = 13.7 microg/ml ), Phytophthora infestans ( IC50 3.4 microg/ml ), Clavibacter michiganensis, Bacillus subtilis , Pseudomonas syringae, Erwinia carotovora, Escherichia coli
Validated : Experimentally Validated
Pfam : PF00304 : ( Gamma-thionin family )
InterPro : IPR008176 : Gamma-thionin.
IPR003614 : Scorpion_toxin-like.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IEA
GO:0050832 Biological Process Defense response to fungus IDA
GO:0050829 Biological Process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological Process Defense response to Gram-positive bacterium IDA
GO:0031640 Biological Process Killing of cells of other organism IDA
Sequence:
KFCEKPSGTWSGVCGNSGACKDQCIRLEGAKHGSCNYKLPAHRCICYYEC