CAMPSQ465
Title : Dermaseptin-2
GenInfo Identifier : 461936, 740958
Source : Phyllomedusa sauvagii [Sauvage frog]
Taxonomy : Animalia, Amphibians
UniProt: P80278
PubMed : 8306981
Length : 34
Activity : Antibacterial, Antifungal
Target : A.fumigatus
Validated : Experimentally Validated
Pfam : PF12121 : ( Dermaseptin )
InterPro : IPR022731 : Dermaseptin.
AMP Family : Dermaseptin
Signature :
ID Type Pattern / HMM T. Length
CAMPDerH HMM Variable
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IEA
GO:0042742 Biological Process Defense response to bacterium IEA
GO:0050832 Biological Process Defense response to fungus IEA
GO:0031640 Biological Process Killing of cells of other organism IEA
Sequence:
ALWFTMLKKLGTMALHAGKAALGAAANTISQGTQ