CAMPSQ570
Title : Beta-defensin 1
GenInfo Identifier : 3023392
Source : Mus musculus [Mouse]
Taxonomy : Animalia, Mammals
NCBI Taxonomy : 10090
UniProt: P56386
PubMed : 9488417
Length : 37
Activity : Antibacterial
Gram Nature : Gram+ve, Gram-ve
Target : E. coli , S. aureus, P. aeruginosa
Validated : Experimentally Validated
Pfam : PF00711 : ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
IPR006080 : Defensin_beta/neutrophil.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IEA
GO:0002526 Biological Process Acute inflammatory response IEA
GO:0042742 Biological Process Defense response to bacterium IEA
GO:0045087 Biological Process Innate immune response IMP
GO:0009617 Biological Process Response to bacterium IMP
GO:0033574 Biological Process Response to testosterone stimulus IEA
Sequence:
DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS