CAMPSQ623
Title : Defensin ARD1
GenInfo Identifier : 74834657
Source : Archaeoprepona demophon [One-spotted leafwing butterfly]
Taxonomy : Animalia, Insects
UniProt: P84156
PDB: 1OZZ, 1P00, 1P0A
Structure Database : CAMPST394, CAMPST395, CAMPST396
PubMed : 14978308
Length : 44
Activity : Antifungal
Target : C. albicans, C. neoformans A, A. fumigatus
Validated : Experimentally Validated
Pfam : PF00537 : ( Scorpion toxin-like domain )
InterPro : IPR001542 : Defensin_invertebrate/fungal.
IPR003614 : Scorpion_toxin-like.
IPR002061 : Scorpion_toxinL/defesin.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region TAS
GO:0008200 Molecular Function Ion channel inhibitor activity IEA
GO:0019732 Biological Process Antifungal humoral response IDA
GO:0045087 Biological Process Innate immune response IEA
GO:0031640 Biological Process Killing of cells of other organism IEA
Sequence:
DKLIGSCVWGAVNYTSNCNAECKRRGYKGGHCGSFANVNCWCET