CAMPSQ674
Title : Defensin
GenInfo Identifier : 28864187
Source : Rhipicephalus microplus [Cattle tick]
Taxonomy : Animalia, Arachnids
NCBI Taxonomy : 6941
UniProt: Q86LE4
PubMed : 14642886
Length : 38
Activity : Antibacterial
Gram Nature : Gram+ve
Validated : Experimentally Validated
Pfam : PF01097 : ( Arthropod defensin )
InterPro : IPR001542 : Defensin_invertebrate/fungal.
IPR003614 : Scorpion_toxin-like.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IDA
GO:0050829 Biological Process Defense response to Gram-negative bacterium ISS
GO:0050830 Biological Process Defense response to Gram-positive bacterium ISS
GO:0045087 Biological Process Innate immune response IEA
Sequence:
GFGCPFNQGACHRHCRSIRRRGGYCAGLIKQTCTCYRN