CAMPSQ729
Title : Heliomicin
GenInfo Identifier : 159162451
Source : Heliothis virescens [Tobacco budworm moth]
Taxonomy : Animalia, Insects
UniProt: P81544
PDB: 1I2U, 1I2V
Structure Database : CAMPST339, CAMPST29
PubMed : 10092609
Length : 44
Activity : Antifungal
Target : N. crassa ( MIC = 0.1-0.2 microM) , F. culmorum ( MIC = 0.2-0.4 microM) , F. oxysporum ( MIC = 1.5-3 microM) , N. haematococca ( MIC = 0.4-0.8 microM) , A. fumigatus ( MIC = 6-12 microM) , T. viride ( MIC = 1.5-3 microM) , C. albicans ( MIC = 2.5-5 microM) , C. neoformans ( MIC = 2.5-5 microM )
Validated : Experimentally Validated
Comment : Inactive against E. coli 363 (50 microM) , M. luteus (50 microM) , C. glabrata (50 microM) , S. cerevisiae (50 microM)
Pfam : PF00537 : ( Scorpion toxin-like domain )
InterPro : IPR001542 : Defensin_invertebrate/fungal.
IPR003614 : Scorpion_toxin-like.
IPR002061 : Scorpion_toxinL/defesin.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IEA
GO:0008200 Molecular Function Ion channel inhibitor activity IEA
GO:0050832 Biological Process Defense response to fungus IEA
GO:0045087 Biological Process Innate immune response IEA
GO:0031640 Biological Process Killing of cells of other organism IEA
Sequence:
DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET