CAMPSQ732
Title : Penaeidin 4
GenInfo Identifier : 157881028
Source : Litopenaeus setiferus [Atlantic white shrimp]
Taxonomy : Animalia, Crustaceans (Malacostraca)
UniProt: Q962A7
PDB: 1XV3
Structure Database : CAMPST84
PubMed : 15699044
Length : 47
Activity : Antibacterial, Antifungal
Gram Nature : Gram+ve
Target : Fusarium oxysporum ( MIC = 0.84-1.26 microM ) , Botrytis cinerea ( MIC = 4.38-6.57 microM ) , Penicillium crustosum ( MIC = 1.26-1.9 microM ) , Aerococcus viridans ( MIC = 1.9-2.92 microM ) , Bacillus megaterium ( MIC > 50 microM )
Validated : Experimentally Validated
Pfam : PF05927 : ( Penaeidin )
InterPro : IPR009226 : Penaeidin.
AMP Family : Penaeidin
Signature :
ID Type Pattern / HMM T. Length
CAMPPenP Pattern G-[HY]-T-x-P-x(1,3)-P-x(0,1)-R-P-[ILP]-x(4)-[IP]-[GILP]-x(3)-[CPV]-x-[CGNT] Variable
CAMPPenH HMM Variable
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005737 Cellular Component Cytoplasm IEA
GO:0008061 Molecular Function Chitin binding IEA
GO:0042742 Biological Process Defense response to bacterium IEA
GO:0050832 Biological Process Defense response to fungus IEA
GO:0031640 Biological Process Killing of cells of other organism IEA
Sequence:
HSSGYTRPLRKPSRPIFIRPIGCDVCYGIPSSTARLCCFRYGDCCHL