| CAMPSQ826 |
| Title : |
Bacteriocin hiracin-JM79 |
| GenInfo Identifier : |
123159786 |
| Source : |
Enterococcus hirae |
| Taxonomy : |
Bacteria |
| NCBI Taxonomy : |
1354 |
| UniProt: |
Q0Z8B6 |
| PubMed : |
17326750 |
| Length : |
44 |
| Activity : |
Antibacterial |
| Gram Nature : |
Gram+ve |
| Target : |
Listeria, Enterococcus, Propionibacterium, Staphylococcus and some strains of Clostridium, Lactobacillus, Pediococcus |
| Validated : |
Experimentally Validated |
| Comment : |
Inactive against gram - bacteria |
| Pfam : |
PF01721 : ( Class II bacteriocin )
|
| InterPro : |
IPR002633 : Bacteriocin_IIa.
IPR023384 : Bacteriocin_IIa_CS.
IPR023388 : Bacteriocin_IIa_dom.
|
| AMP Family : |
Bacteriocin |
| Signature : |
| ID |
Type |
Pattern / HMM |
T. Length |
|
CAMPBacH35 |
HMM |
 |
35 |
|
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0005576 |
Cellular Component |
Extracellular region |
IDA |
| GO:0019835 |
Biological Process |
Cytolysis |
IEA |
| GO:0050830 |
Biological Process |
Defense response to Gram-positive bacterium |
IDA |
|
Sequence: |
ATYYGNGLYCNKEKCWVDWNQAKGEIGKIIVNGWVNHGPWAPRR |
