CAMPSQ883
Title : Andropin
GenInfo Identifier : 113829
Source : Drosophila melanogaster [Fruit fly]
Taxonomy : Animalia, Insects
UniProt: P21663
PubMed : 1899226
Length : 34
Activity : Antibacterial
Gram Nature : Gram+ve, Gram-ve
Target : Escherichia coli D21 ( MIC = 140 microM) , Enterobacter cloacae b312 ( MIC > 300 microM) , Pseudomonas aeruginosa OT97 ( MIC > 300 microM) , Serratia marcescens Db 11 ( MIC > 127 microM) , Serratia marcescens Db 1140 ( MIC > 127 microM) , Bacillus megatherium Bml1 ( MIC = 11 microM) , Bacillus subtilis Bs11 ( MIC = 17 microM) , Micrococcus luteus MIll ( MIC = 20 microM)
Validated : Experimentally Validated
Pfam : PF00272 : ( Cecropin family )
InterPro : IPR000875 : Cecropin.
AMP Family : Cecropin
Signature :
ID Type Pattern / HMM T. Length
CAMPCecH HMM Variable
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular Component Extracellular space IDA
GO:0045087 Biological Process Innate immune response IEA
GO:0006962 Biological Process Male-specific antibacterial humoral response IDA
GO:0032504 Biological Process Multicellular organism reproduction IEP
GO:0006965 Biological Process Positive regulation of biosynthetic process of antibacterial peptides active against Gram-positive bacteria IDA
Sequence:
VFIDILDKVENAIHNAAQVGIGFAKPFEKLINPK