CAMPSQ885
Title : Spheniscin-2
GenInfo Identifier : 41019461
Source : Aptenodytes patagonicus [King penguin]
Taxonomy : Animalia, Aves
NCBI Taxonomy : 9234
UniProt: P83430
PDB: 1UT3
Structure Database : CAMPST647
PubMed : 14525994 , 15123713
Length : 38
Activity : Antibacterial, Antifungal
Gram Nature : Gram+ve, Gram-ve
Target : M. luteus ( MIC = 1.5-3.0 microM) , B. subtilis ( MIC = 0.8-1.5 microM) , B. cereus ATCC 11778 ( MIC = 3-6 microM) , B. megaterium ( MIC = 0.4-0.8 microM) , S. aureus ( MIC = 1.5-3.0 microM) , S. saprophyticus ( MIC = 1.5-3.0 microM) , S. haemolyticus ( MIC = 1.5-3.0 microM) , N. asteroides ( MIC = 0.8-1.5 microM) , A. viridans ( MIC = 0.4-0.8 microM) , L. monocytogenes ( MIC = 6-12 microM) , E. coli SBS 363 ( MIC = 0.8-1.5 microM) , E. coli 1106 ( MIC = 1.5-3.0 microM) , S. typhimurium ( MIC = 6-12 microM) , K. pneumoniae ( MIC = 50-100 microM) , P. aeruginosa ATCC 82118 ( MIC = 6-12 microM) , V. metshnikovii NCTC 8483 ( MIC = 25-50 microM) , V. anguillarum ATCC 19264 ( MIC = 25-50 microM) , C. glabrata ( MIC > 100 microM) , C. albicans IHEM 8060 ( MIC = 50-100 microM) , C. tropicalis ( MIC = 1.5-3.0 microM) , N. crassa ( MIC = 3-6 microM) , A. fumigatus ( MIC = 3-6 microM)
Validated : Experimentally Validated
Comment : Inactive against E. cloacae , A. faecalis
Pfam : PF00711 : ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IEA
GO:0042742 Biological Process Defense response to bacterium IEA
GO:0050832 Biological Process Defense response to fungus IEA
GO:0031640 Biological Process Killing of cells of other organism IEA
Sequence:
SFGLCRLRRGFCARGRCRFPSIPIGRCSRFVQCCRRVW