| CAMPSQ888 |
| Title : |
Defensin |
| GenInfo Identifier : |
37999545 |
| Source : |
Dermacentor variabilis [American dog tick] |
| Taxonomy : |
Animalia, Arachnids |
| NCBI Taxonomy : |
34621 |
| UniProt: |
Q86QI5 |
| PubMed : |
11439245 |
| Length : |
36 |
| Activity : |
Antibacterial |
| Gram Nature : |
Gram+ve, Gram-ve |
| Target : |
B. subtilis B. burgdorferi |
| Validated : |
Experimentally Validated |
| Pfam : |
PF01097 : ( Arthropod defensin )
|
| InterPro : |
IPR001542 : Defensin_invertebrate/fungal.
IPR003614 : Scorpion_toxin-like.
|
| AMP Family : |
Defensin |
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0005576 |
Cellular Component |
Extracellular region |
IDA |
| GO:0050829 |
Biological Process |
Defense response to Gram-negative bacterium |
IDA |
| GO:0050830 |
Biological Process |
Defense response to Gram-positive bacterium |
IDA |
|
Sequence: |
GFGCPLNQGACHNHCRSIRRRGGYCSGIIKQTCTCY |
