CAMPSQ898
Title : Neutrophil cationic antibacterial polypeptide of 11 kDa
GenInfo Identifier : 81867362
Source : Cavia porcellus [Guinea pig]
Taxonomy : Animalia, Mammals
NCBI Taxonomy : 10141
UniProt: Q91X12
PubMed : 8644997
Length : 43
Activity : Antibacterial
Gram Nature : Gram+ve, Gram-ve
Target : E. coli ( ED50 = 30-35 nM ) , S.aureus ( ED50 = 90-120 nM )
Validated : Experimentally Validated
Pfam : PF00666 : ( Cathelicidin )
InterPro : IPR001894 : Cathelicidin.
IPR018216 : Cathelicidin_CS.
AMP Family : Cathelicidin
Signature :
ID Type Pattern / HMM T. Length
CAMPCatH HMM Variable
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IEA
GO:0042581 Cellular Component Specific granule IEA
GO:0050829 Biological Process Defense response to Gram-negative bacterium IEA
GO:0050830 Biological Process Defense response to Gram-positive bacterium IEA
GO:0051873 Biological Process Killing by host of symbiont cells IEA
GO:0044130 Biological Process Negative regulation of growth of symbiont in host IEA
GO:0044140 Biological Process Negative regulation of growth of symbiont on or near host surface IEA
Sequence:
GLRKKFRKTRKRIQKLGRKIGKTGRKVWKAWREYGQIPYPCRI