CAMPSQ911
Title : Defensin AMP1 , Ah-Amp1
GenInfo Identifier : 75139849
Source : Aesculus hippocastanum [Horse chestnut]
Taxonomy : Viridiplantae
NCBI Taxonomy : 43364
UniProt: Q7M1F3
PDB: 1BK8
Structure Database : CAMPST2
PubMed : 7628617
Length : 50
Activity : Antifungal
Target : Botrytis cinerea ( IC50 = 25 microg/ml) , Cladosporium sphaerospermum ( IC50 = 0.5 microg/ml) , Fusarium culmorum ( IC50 = 12 microg/ml) , Leptosphaeria maculans ( IC50 = 0.5 microg/ml) , Penicillium digitatum ( IC50 = 6 microg/ml) , Trichoderma viride ( IC50 >100 microg/ml) , Septoria tritiei ( IC50 = 0.5 microg/ml) , Verticilium albo-atrum ( IC50 = 6 microg/ml) , Neurospora crassa ( IC50 = 0.3 microg/ml)
Validated : Experimentally Validated
Pfam : PF00304 : ( Gamma-thionin family )
InterPro : IPR008176 : Gamma-thionin.
IPR003614 : Scorpion_toxin-like.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IEA
GO:0050832 Biological Process Defense response to fungus IEA
GO:0031640 Biological Process Killing of cells of other organism IEA
Sequence:
LCNERPSQTWSGNCGNTAHCDKQCQDWEKASHGACHKRENHWKCFCYFNC