CAMPSQ918
Title : Cysteine-rich antifungal protein 2 (Sa-AFP2)
GenInfo Identifier : 1703192
Source : Sinapis alba [White mustard]
Taxonomy : Viridiplantae
NCBI Taxonomy : 3728
UniProt: P30232
PubMed : 8422949
Length : 51
Activity : Antifungal
Target : Alternaria brassicola ( MIC = 4.5 microg/ml ) , Botrytis cinerea ( MIC = 3.5 microg/ml ) , Fusarium culmorum ( MIC = 2.3 microg/ml ) , Fusarium oxysporum f.sp.lycopersici ( MIC = 2.3 microg/ml ) , Pyricularia oryzae ( MIC = 0.3 microg/ml ) , Verticillium dahliae ( MIC = 1.2 microg/ml )
Validated : Experimentally Validated
Pfam : PF00304 : ( Gamma-thionin family )
InterPro : IPR008176 : Gamma-thionin.
IPR003614 : Scorpion_toxin-like.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0050832 Biological Process Defense response to fungus IEA
GO:0031640 Biological Process Killing of cells of other organism IEA
Sequence:
QKLCQRPSGTWSGVCGNNNACRNQCINLEKARHGSCNYVFPAHKCICYFPC