CAMPSQ921
Title : Floral defensin-like protein 2
GenInfo Identifier : 44887845
Source : Petunia x hybrida [Petunia]
Taxonomy : Viridiplantae
UniProt: Q8H6Q0
PubMed : 12644678
Length : 49
Activity : Antifungal
Target : F.?oxysporum ( 86% inhibition at 10 microg/ml) , B. cinerea ( 41% inhibition at 10 microg/ml )
Validated : Experimentally Validated
Pfam : PF00304 : ( Gamma-thionin family )
InterPro : IPR008176 : Gamma-thionin.
IPR003614 : Scorpion_toxin-like.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IEA
GO:0005773 Cellular Component Vacuole IEA
GO:0050832 Biological Process Defense response to fungus IEA
GO:0031640 Biological Process Killing of cells of other organism IEA
Sequence:
GTCKAECPTWEGICINKAPCVKCCKAQPEKFTDGHCSKILRRCLCTKPC