CAMPSQ922
Title : Cysteine-rich antifungal protein 2
GenInfo Identifier : 1703206
Source : Raphanus sativus [Radish]
Taxonomy : Viridiplantae
UniProt: P30230
PubMed : 7780308
Length : 51
Activity : Antifungal
Target : A. brassicola ( MIC = 2 microg/ml) , Botrytis cinerea ( MIC = 2 microg/ml) , F. culmorum ( MIC = 2 microg/ml)
Validated : Experimentally Validated
Pfam : PF00304 : ( Gamma-thionin family )
InterPro : IPR008176 : Gamma-thionin.
IPR003614 : Scorpion_toxin-like.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IEA
GO:0050832 Biological Process Defense response to fungus IEA
GO:0031640 Biological Process Killing of cells of other organism IEA
Sequence:
QKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC