CAMPSQ930
Title : Tachystatin-A 1
GenInfo Identifier : 150387843
Source : Tachypleus tridentatus [Japanese horseshoe crab]
Taxonomy : Animalia
UniProt: P0C1Z7
PubMed : 10473569
Length : 44
Activity : Antibacterial, Antifungal
Gram Nature : Gram+ve, Gram-ve
Target : E. coli ( IC50 = 25 microg/ml ) , S. aureus ( IC50 = 4.2 microg/ml ) , C. albicans ( IC50 = 3.0 microg/ml ) , P. pastoris( IC50 = 0.5 microg/ml )
Validated : Experimentally Validated
Pfam : PF11406 : ( Antimicrobial peptide tachystatin A )
InterPro : IPR022717 : Antimicrobial_tachystatin_A.
IPR009030 : Growth_fac_rcpt_N_dom.
AMP Family : Tachystatin
Signature :
ID Type Pattern / HMM T. Length
CAMPTacH HMM Variable
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IEA
GO:0042742 Biological Process Defense response to bacterium IEA
GO:0050832 Biological Process Defense response to fungus IEA
GO:0031640 Biological Process Killing of cells of other organism IEA
Sequence:
YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRF